Return to main results Retrieve Phyre Job Id

Job DescriptionO13736
Confidence24.23%DateSun Jul 8 11:46:01 BST 2012
Rank346Aligned Residues30
% Identity13%Templatec2fvuA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:regulatory protein sir3; PDBTitle: structure of the yeast sir3 bah domain
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   94.....100.........110...... ...120...
Predicted Secondary structure 

















..............
Query SS confidence 






















. . . . . . . . . . . . . .






Query Sequence  QSVDEISFQADQTLDCYGDTDSD. . . . . . . . . . . . . . WILVGFN
Query Conservation     




  
    
    
  ..............
      
Alig confidence 






















..............






Template Conservation 
  


    





      
 




 






     

Template Sequence  RISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLVEIWVFSYLR
Template Known Secondary structure  TTT

TT
TTTT


Template Predicted Secondary structure 














Template SS confidence 











































   43......50.........60.........70.........80......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions