Return to main results Retrieve Phyre Job Id

Job DescriptionC6Y4B6
Confidence1.25%DateSun Jul 8 11:45:07 BST 2012
Rank80Aligned Residues21
% Identity48%Templatec4ainB_
PDB info PDB header:membrane proteinChain: B: PDB Molecule:glycine betaine transporter betp; PDBTitle: crystal structure of betp with asymmetric protomers.
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40...
Predicted Secondary structure 








Query SS confidence 






























Query Sequence  PLFGIFVGTYGYYLYEKEHRPRGRSLRELAL
Query Conservation 




 

 






   

 



 


 
Alig confidence 










..........









Template Conservation 



 





..........






 

Template Sequence  PFVGMFLARIS. . . . . . . . . . RGRSIREFIL
Template Known Secondary structure  T
..........SS

Template Predicted Secondary structure  ..........


Template SS confidence 






























   379380......... 390.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions