Return to main results Retrieve Phyre Job Id

Job DescriptionC6Y4C2
Confidence7.79%DateSun Jul 8 11:45:08 BST 2012
Rank52Aligned Residues41
% Identity27%Templatec1yv0I_
PDB info PDB header:contractile proteinChain: I: PDB Molecule:troponin i, fast skeletal muscle; PDBTitle: crystal structure of skeletal muscle troponin in the ca2+-2 free state
Resolution7.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40.........50.........60.........70.........80........
Predicted Secondary structure 






Query SS confidence 






















































Query Sequence  VAEQEEFNAKIEDMALKLLSEKYDNEAYQAELFYRLSNCVEKVLHNKISITDLKT
Query Conservation 


 

 
 


 
 
 
  

 
 
    


 
     


    
 

    
Alig confidence 


























..............













Template Conservation    






 

  
  








 ..............

 
 
 

 

  
Template Sequence  MQELQELSKKLHAKIDSVDEERYDTEV. . . . . . . . . . . . . . KLQKTNKELEDLSQ
Template Known Secondary structure  ..............
Template Predicted Secondary structure  ..............
Template SS confidence 






















































   57..60.........70.........80... ......90.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions