Return to main results Retrieve Phyre Job Id

Job DescriptionC6Y4C9
Confidence48.11%DateSun Jul 8 11:45:10 BST 2012
Rank27Aligned Residues65
% Identity22%Templatec1wt6B_
PDB info PDB header:transferaseChain: B: PDB Molecule:myotonin-protein kinase; PDBTitle: coiled-coil domain of dmpk
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40.........50.........60.........70.........80.........90.........100.........110...
Predicted Secondary structure 

Query SS confidence 















































































Query Sequence  NNANTLAITHLKEQLSREVQRREELEGLLEQSQKEMEDLSVSLFTEANEMVAKARQDTEVLKRELDYLRAKEKGRIGKLR
Query Conservation    
       
  

  
 
 
  

     
  






 

 


 

  

      

 
 

        
 
 
Alig confidence 































......................

























Template Conservation         
 









 


 
 


 

......................
   
     
 
 


   
  

 
Template Sequence  EAEAEVTLRELQEALEEEVLTRQSLSREMEAI. . . . . . . . . . . . . . . . . . . . . . RTDNQNFASQLREAEARNRDLEAHVR
Template Known Secondary structure 

......................
Template Predicted Secondary structure 

......................
Template SS confidence 















































































   2.......10.........20.........30... ......40.........50.........
 
   114.....120
Predicted Secondary structure 
Query SS confidence 






Query Sequence  SIQTAVR
Query Conservation 

   
 
Alig confidence 






Template Conservation   
    
Template Sequence  QLQERME
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 






   60......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions