Return to main results Retrieve Phyre Job Id

Job DescriptionC6Y4D2
Confidence10.39%DateSun Jul 8 11:45:10 BST 2012
Rank14Aligned Residues28
% Identity25%Templatec1vsy7_
PDB info PDB header:hydrolaseChain: 7: PDB Molecule:proteasome activator blm10; PDBTitle: proteasome activator complex
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   94.....100.........110.........120.........130.....
Predicted Secondary structure 

















Query SS confidence 









































Query Sequence  MRSKQLETISSDIQKALKELHHESSPENIKEAHKQDYSPPSN
Query Conservation 
 

 

 
   
 


         
  

  
     
 
Alig confidence 




















..............






Template Conservation 
 
     

  
  

  

..............

 



Template Sequence  INGSKKDRFFEKLVSLAKAIE. . . . . . . . . . . . . . TFIHPSN
Template Known Secondary structure 

TTS
TTT..............STT
Template Predicted Secondary structure 





..............






Template SS confidence 









































   499500.........510......... 520......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions