Return to main results Retrieve Phyre Job Id

Job DescriptionA6X977
Confidence0.80%DateSun Jul 8 11:45:02 BST 2012
Rank89Aligned Residues35
% Identity11%Templated1tvfa2
SCOP infobeta-lactamase/transpeptidase-like beta-lactamase/transpeptidase-like beta-Lactamase/D-ala carboxypeptidase
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20..... ....30.........
Predicted Secondary structure 






............

Query SS confidence 




















. . . . . . . . . . . .













Query Sequence  GCFVTEKESGGHTQITVTRKP. . . . . . . . . . . . QKKVSSMLNRGFAH
Query Conservation 




















............













Alig confidence 




















............













Template Conservation     
      
   
 


             
      


  
  
Template Sequence  YNHTITTKRGKFRINQVIMGAGDYKNLGGEKQRNMMGNALMERSFDQ
Template Known Secondary structure  TTSBTTTTB
Template Predicted Secondary structure 













Template SS confidence 














































   268.270.........280.........290.........300.........310....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions