Return to main results Retrieve Phyre Job Id

Job DescriptionA6X977
Confidence1.19%DateSun Jul 8 11:45:02 BST 2012
Rank45Aligned Residues34
% Identity18%Templatec1tvfA_
PDB info PDB header:penicillin bindingChain: A: PDB Molecule:penicillin binding protein 4; PDBTitle: crystal structure of penicillin-binding protein 4 (pbp4)2 from staphylococcus aureus
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10.........20.... .....30.........
Predicted Secondary structure 





............


Query SS confidence 


















. . . . . . . . . . . .














Query Sequence  CFVTEKESGGHTQITVTRK. . . . . . . . . . . . PQKKVSSMLNRGFAH
Query Conservation 


















............














Alig confidence 


















............














Template Conservation   

  
 
 
 


 



            
      

 
 
  
Template Sequence  NHTITTKRGKFRINQVIMGAGDYKNLGGEKQRNMMGNALMERSFDQ
Template Known Secondary structure  TTSBTTTTB
Template Predicted Secondary structure 











Template SS confidence 













































   269270.........280.........290.........300.........310....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions