Return to main results Retrieve Phyre Job Id

Job DescriptionC6Y4C1
Confidence8.61%DateSun Jul 8 11:45:08 BST 2012
Rank13Aligned Residues23
% Identity17%Templatec1b9xC_
PDB info PDB header:signaling proteinChain: C: PDB Molecule:protein (phosducin); PDBTitle: structural analysis of phosducin and its phosphorylation-2 regulated interaction with transducin
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   36...40.... .....50........
Predicted Secondary structure  ...........
Query SS confidence 








. . . . . . . . . . .













Query Sequence  AGVQKDDER. . . . . . . . . . . KRIKKERFEDLKRQ
Query Conservation 





 

...........
  


       
Alig confidence 








...........













Template Conservation 



 
     

 


  
   
  

 

   
Template Sequence  KGVINDWRKFKLESEDEGCLRKYRRQCMQDMHQK
Template Known Secondary structure  T

Template Predicted Secondary structure 


Template SS confidence 

































   23......30.........40.........50......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions