Return to main results Retrieve Phyre Job Id

Job DescriptionC6Y4C0
Confidence36.79%DateSun Jul 8 11:45:08 BST 2012
Rank234Aligned Residues25
% Identity16%Templatec3trzE_
PDB info PDB header:rna binding protein/rnaChain: E: PDB Molecule:protein lin-28 homolog a; PDBTitle: mouse lin28a in complex with let-7d microrna pre-element
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   36...40.........50.........60.......
Predicted Secondary structure 





















Query SS confidence 































Query Sequence  QAFEKWGRIVRCDIPISSNPQAHRYAFVEFEE
Query Conservation    
   
 
    
           


 
  
Alig confidence 












.......











Template Conservation        
 

 

.......  





  
 
Template Sequence  QLLHGAGICKWFN. . . . . . . VRMGFGFLSMTA
Template Known Secondary structure 
S.......TTTT
Template Predicted Secondary structure 



.......






Template SS confidence 































   36...40........ .50.........60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions