Return to main results Retrieve Phyre Job Id

Job DescriptionA2P2R3
Confidence4.22%DateMon Jul 2 19:10:01 BST 2012
Rank84Aligned Residues25
% Identity36%Templatec2p0fA_
PDB info PDB header:ligand binding proteinChain: A: PDB Molecule:rho gtpase-activating protein 9; PDBTitle: arhgap9 ph domain in complex with ins(1,3,5)p3
Resolution1.91 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   133......140.........150.........160.........170.....
Predicted Secondary structure 














Query SS confidence 










































Query Sequence  YVFKSDTDTECIPKLYKHIYDTSIELGYNLDFHVLTNLVLKEL
Query Conservation    
 
 





  

                          
Alig confidence 










..................













Template Conservation 
 
 
 

 
 ..................  

 

  

  
Template Sequence  FLLQSDHETEL. . . . . . . . . . . . . . . . . . RAWHRALRTVIERL
Template Known Secondary structure 
S
..................
Template Predicted Secondary structure 

..................
Template SS confidence 










































   413......420... ......430.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions