Return to main results Retrieve Phyre Job Id

Job DescriptionA2P2R3
Confidence14.51%DateMon Jul 2 19:10:01 BST 2012
Rank33Aligned Residues23
% Identity30%Templatec2a45L_
PDB info PDB header:hydrolase/hydrolase inhibitorChain: L: PDB Molecule:fibrinogen gamma chain; PDBTitle: crystal structure of the complex between thrombin and the central "e"2 region of fibrin
Resolution3.65 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.
Predicted Secondary structure 









Query SS confidence 






























Query Sequence  MCGIFGYCNFLIEKTRGEIIDTLIEGLQALE
Query Conservation 



 
                
   
  

Alig confidence 








........













Template Conservation 





 

........


  





 

Template Sequence  TCGIADFLS. . . . . . . . TYQTKVDKDLQSLE
Template Known Secondary structure  ........
Template Predicted Secondary structure  ........
Template SS confidence 






























   22.......30 .........40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions