Return to main results Retrieve Phyre Job Id

Job DescriptionO13297
Confidence6.66%DateMon Jul 2 19:10:04 BST 2012
Rank53Aligned Residues49
% Identity20%Templatec2p61A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein tm_1646; PDBTitle: crystal structure of protein tm1646 from thermotoga2 maritima, pfam duf327
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   501........510.... .....520..... ....530.........540.........
Predicted Secondary structure 


.......................






Query SS confidence 













. . . . .










. . . . . . . . . . . . . . . . . .























Query Sequence  ALLNAFDNITNDSK. . . . . EYASLIRTFLN. . . . . . . . . . . . . . . . . . NGTIIRRKLSSLSYEIFEGSKKVM
Query Conservation                ..... 
  

  
  ..................
 
 
 
                 
Alig confidence 













.....










..................























Template Conservation   
   
  
    
   
  

  

 

   
   
    

 
 
 

  

 

  
   

  

  
Template Sequence  EVIDSGNELVRSPTPSNLKRYKNAIKEFLKLIEKKIYKLNSGRARLHLVVEEVNEKLMDLTEKIMKNEWQTI
Template Known Secondary structure 





TT
TTT
Template Predicted Secondary structure 







Template SS confidence 







































































   57..60.........70.........80.........90.........100.........110.........120........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions