Return to main results Retrieve Phyre Job Id

Job DescriptionD6VPM8
Confidence15.55%DateMon Jul 2 19:10:02 BST 2012
Rank12Aligned Residues34
% Identity21%Templatec2ebiA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:dna binding protein gt-1; PDBTitle: arabidopsis gt-1 dna-binding domain with t133d phosphomimetic mutation
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   68.70.........80.........90.........100.........110.
Predicted Secondary structure 
















Query SS confidence 











































Query Sequence  PSIAGKEWKTITYNMNQYLFKAGLWKTPYHFFCEHQCYEFFKDL
Query Conservation 

 
 
 

 

  

 


  
 
 







  
   

 
Alig confidence 

















..........















Template Conservation     
   
  
   
   ..........
  

  

  

 

Template Sequence  SKSNKHLWEQISSKMREK. . . . . . . . . . GFDRSPDMCTDKWRNL
Template Known Secondary structure  SS

..........



Template Predicted Secondary structure 



..........




Template SS confidence 











































   109110.........120...... ...130.........140..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions