Return to main results Retrieve Phyre Job Id

Job DescriptionD6VPM8
Confidence4.83%DateMon Jul 2 19:10:02 BST 2012
Rank65Aligned Residues40
% Identity15%Templatec1guuA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:myb proto-oncogene protein; PDBTitle: crystal structure of c-myb r1
Resolution1.6 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   58.60.........70.........80.........90.........100.........110.....
Predicted Secondary structure 





















Query SS confidence 

























































Query Sequence  KLLLEVITHRPSIAGKEWKTITYNMNQYLFKAGLWKTPYHFFCEHQCYEFFKDLIKGK
Query Conservation 


 


   

 
 
 

 

  

 


  
 
 







  
   

 

  
Alig confidence 













...









..............













.

Template Conservation    
   
   
   ...
  

     ..............

  


 

   
. 
Template Sequence  EKLKKLVEQNGTDD. . . WKVIANYLPN. . . . . . . . . . . . . . RTDVQCQHRWQKVL. NP
Template Known Secondary structure 
SS
...TSTT..............

.S
Template Predicted Secondary structure 



...


..............



.

Template SS confidence 

























































   4950.........60.. .......70.. .......80...... ..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions