Return to main results Retrieve Phyre Job Id

Job DescriptionO14464
Confidence1.71%DateMon Jul 2 19:10:21 BST 2012
Rank67Aligned Residues34
% Identity21%Templatec1e42A_
PDB info PDB header:endocytosisChain: A: PDB Molecule:ap-2 complex subunit beta; PDBTitle: beta2-adaptin appendage domain, from clathrin adaptor ap2
Resolution1.7 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   36...40.........50.........60.........70.........80..
Predicted Secondary structure 






















Query SS confidence 














































Query Sequence  VAAPQPALVAANRPLVFNRGFKVRTSVKKFCSDCYLVRRKGRVYIYC
Query Conservation     
               




 



 
  
  


 

 

 
Alig confidence 














....






.........











Template Conservation     
  
        ....

 
 
 .........     
 
 
 
Template Sequence  YVAPKAVWLPAVKAK. . . . GLEISGT. . . . . . . . . FTHRQGHIYMEM
Template Known Secondary structure 





GGGTT....T.........TT
Template Predicted Secondary structure 








.............

Template SS confidence 














































   707..710.........720. ....... .730.........740
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions