Return to main results Retrieve Phyre Job Id

Job DescriptionO13527
Confidence20.10%DateMon Jul 2 19:10:08 BST 2012
Rank59Aligned Residues37
% Identity22%Templatec3nnqA_
PDB info PDB header:viral proteinChain: A: PDB Molecule:n-terminal domain of moloney murine leukemia virus PDBTitle: crystal structure of the n-terminal domain of moloney murine leukemia2 virus integrase, northeast structural genomics consortium target or3
Resolution2.69 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40...... ...50.........60.........70.........80........
Predicted Secondary structure 





.....






















Query SS confidence 














. . . . .









































Query Sequence  ANILILSFIECLRMP. . . . . MHRQIRYSLKNNTITYFNESDVDWSSAIDYQCPDCLIGKSTK
Query Conservation                 .....                               
  
  

   
Alig confidence 














.....










....................










Template Conservation 

 
  


 
    



 
   
   
  ....................
  


 
 
 
Template Sequence  SFSKXKALLERSHSPYYXLNRDRTLKNITET. . . . . . . . . . . . . . . . . . . . CKACAQVNASK
Template Known Secondary structure 


SSTT....................



Template Predicted Secondary structure 






....................



Template SS confidence 





























































   64.....70.........80.........90.... .....100.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions