Return to main results Retrieve Phyre Job Id

Job DescriptionO13527
Confidence10.75%DateMon Jul 2 19:10:08 BST 2012
Rank97Aligned Residues39
% Identity21%Templatec2px2B_
PDB info PDB header:transferaseChain: B: PDB Molecule:genome polyprotein [contains: capsid protein c PDBTitle: crystal structure of the murray valley encephalitis virus2 ns5 2'-o methyltransferase domain in complex with sah3 (monoclinic form 1)
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   985....990.........1000.........1010.........1020.........1030.......
Predicted Secondary structure 
















Query SS confidence 




















































Query Sequence  SYVGYKFRFDLLYYINTLAQHILFPSRQVLDMTYELIQFMWDTRDKQLIWHKN
Query Conservation   


  








  


    
   
  
 







 
   

     
Alig confidence 



















..............


















Template Conservation 

 


 
      
     .............. 
  
      
      
Template Sequence  MYWVSGASGNIVHAVNMTSQ. . . . . . . . . . . . . . VLIGRMDKKIWKGPKYEED
Template Known Secondary structure  TT

S
..............TSS
SS





Template Predicted Secondary structure 





..............










Template SS confidence 




















































   219220.........230........ .240.........250.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions