Return to main results Retrieve Phyre Job Id

Job DescriptionO13563
Confidence18.02%DateMon Jul 2 19:10:15 BST 2012
Rank14Aligned Residues18
% Identity33%Templated1qqga2
SCOP infoPH domain-like barrel PH domain-like Phosphotyrosine-binding domain (PTB)
Resolution2.30

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   99100.........110.........120.........
Predicted Secondary structure 







Query SS confidence 






























Query Sequence  FWLQEKNSGNLPLNELSAKDKEIYNKMIGVL
Query Conservation 




          

 

  
  


 

Alig confidence 







.............









Template Conservation 
     
 .............  

 

  
Template Sequence  FWMQVDDS. . . . . . . . . . . . . VVAQNMHETI
Template Known Secondary structure 
S
.............
Template Predicted Secondary structure 


.............
Template SS confidence 






























   236...240... ......250...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions