Return to main results Retrieve Phyre Job Id

Job DescriptionO13563
Confidence3.49%DateMon Jul 2 19:10:15 BST 2012
Rank99Aligned Residues21
% Identity38%Templatec1w36E_
PDB info PDB header:recombinationChain: E: PDB Molecule:exodeoxyribonuclease v beta chain; PDBTitle: recbcd:dna complex
Resolution3.1 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   82.......90..... ....100..
Predicted Secondary structure 






..................
Query SS confidence 













. . . . . . . . . . . . . . . . . .






Query Sequence  KSGRIFALVFSSNE. . . . . . . . . . . . . . . . . . RYFFWLQ
Query Conservation   








 
  ..................  




Alig confidence 













..................






Template Conservation    
   






 

     
    
        
 

Template Sequence  HEGRYYLLDYKSNWLGEDSSAYTQQAMAAAMQAHRYDLQ
Template Known Secondary structure  SSS





SSGGGSBTTT
Template Predicted Secondary structure 















Template SS confidence 






































   1072.......1080.........1090.........1100.........1110
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions