Return to main results Retrieve Phyre Job Id

Job DescriptionP32790
Confidence22.80%DateMon Jul 2 19:16:44 BST 2012
Rank353Aligned Residues31
% Identity16%Templatec3d6xA_
PDB info PDB header:lyaseChain: A: PDB Molecule:(3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; PDBTitle: crystal structure of campylobacter jejuni fabz
Resolution2.59 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30.........40.........50.........60.....
Predicted Secondary structure 
























Query SS confidence 











































Query Sequence  LAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTYI
Query Conservation 
    

 
          

               
  
  

Alig confidence 





















.............








Template Conservation          
     
       ............. 


   
 
Template Sequence  TELKVKEVVLGYKNISISDHVF. . . . . . . . . . . . . XGHFPGHPI
Template Known Secondary structure  TTT

TTST.............S
TTS

Template Predicted Secondary structure 








.............








Template SS confidence 











































   24.....30.........40..... ....50....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions