Return to main results Retrieve Phyre Job Id

Job DescriptionP32790
Confidence26.57%DateMon Jul 2 19:16:44 BST 2012
Rank329Aligned Residues28
% Identity14%Templatec2zgtB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:anti-tumor lectin; PDBTitle: crystal structure of agrocybe aegerita lectin aal mutant2 f93g
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30.........40.........50.........60.
Predicted Secondary structure 




















Query SS confidence 





































Query Sequence  IQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVP
Query Conservation     

 
          

               
  
Alig confidence 












..



........










Template Conservation 
    

 

   .. 
 
........
 


     
Template Sequence  LQENVIIFNSRQP. . DGPW. . . . . . . . LVEQRVSDVAG
Template Known Secondary structure  TTTT
S..S


........



TT

Template Predicted Secondary structure 








..



........







Template SS confidence 





































   64.....70...... ...80 .........90.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions