Return to main results Retrieve Phyre Job Id

Job DescriptionP32790
Confidence23.75%DateMon Jul 2 19:16:44 BST 2012
Rank344Aligned Residues37
% Identity32%Templatec1yfsB_
PDB info PDB header:ligaseChain: B: PDB Molecule:alanyl-trna synthetase; PDBTitle: the crystal structure of alanyl-trna synthetase in complex2 with l-alanine
Resolution2.08 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20. ........30.........40.........50........
Predicted Secondary structure 








.........






















Query SS confidence 


















. . . . . . . . .




































Query Sequence  VFLGIYRAVYAYEPQTPEE. . . . . . . . . LAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVG
Query Conservation         
 
        
.........
    

 
          

               
Alig confidence 





.........



.........













...




.......







Template Conservation 




 .........  
 

  

    

   

      ...



 ....... 
  



Template Sequence  LYVSVY. . . . . . . . . KDDEEAYRIWNEHIGIPSERIWRLGEE. . . DNFWQ. . . . . . . MGDVGPCG
Template Known Secondary structure  .........TT
TTT


GGG
..........SSSS
Template Predicted Secondary structure 
.........









...




.......







Template SS confidence 
































































   125....130 .........140.........150....... ..160.. .......170
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions