Return to main results Retrieve Phyre Job Id

Job DescriptionO13516
Confidence3.47%DateMon Jul 2 19:10:06 BST 2012
Rank92Aligned Residues42
% Identity14%Templatec3pp5A_
PDB info PDB header:structural proteinChain: A: PDB Molecule:brk1; PDBTitle: high-resolution structure of the trimeric scar/wave complex precursor2 brk1
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   46...50.........60.........70.........80.........90.........100.........110..
Predicted Secondary structure 
















Query SS confidence 


































































Query Sequence  SFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKVEDFLERRLQTQ
Query Conservation     
 


  

 
  
      
      

 

   


      
  
  
 
   





  
Alig confidence 
































.........................








Template Conservation 
 

  
 

  


 

 
 
 


 





......................... 




  
Template Sequence  EDMSINIQKIVEFLNKFELSTRNKLSDLNEKLT. . . . . . . . . . . . . . . . . . . . . . . . . ILDRQVDYL
Template Known Secondary structure  .........................
Template Predicted Secondary structure  .........................
Template SS confidence 


































































   18.20.........30.........40.........50 .........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions