Return to main results Retrieve Phyre Job Id

Job DescriptionO13549
Confidence27.67%DateMon Jul 2 19:10:13 BST 2012
Rank2Aligned Residues26
% Identity42%Templatec2vxdA_
PDB info PDB header:nuclear proteinChain: A: PDB Molecule:nucleophosmin; PDBTitle: the structure of the c-terminal domain of nucleophosmin
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30....... ..40.......
Predicted Secondary structure 




..........
Query SS confidence 















. . . . . . . . . .









Query Sequence  KGKSQPKRERKKQNYW. . . . . . . . . . VLKSLWKRPQ
Query Conservation 















..........









Alig confidence 















..........









Template Conservation 

  


 
 

 



  
  

 






 


Template Sequence  KGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRK
Template Known Secondary structure  TT



SS



Template Predicted Secondary structure 










Template SS confidence 



































   17..20.........30.........40.........50..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions