Return to main results Retrieve Phyre Job Id

Job DescriptionO13549
Confidence17.79%DateMon Jul 2 19:10:13 BST 2012
Rank4Aligned Residues26
% Identity42%Templatec2llhA_
PDB info PDB header:dna binding protein, chaperoneChain: A: PDB Molecule:nucleophosmin; PDBTitle: nmr structure of npm1_c70
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30....... ..40.......
Predicted Secondary structure 




..........
Query SS confidence 















. . . . . . . . . .









Query Sequence  KGKSQPKRERKKQNYW. . . . . . . . . . VLKSLWKRPQ
Query Conservation 















..........









Alig confidence 















..........









Template Conservation 

  


 
 

 



  
  

 






 


Template Sequence  KGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRK
Template Known Secondary structure  TS



SS



Template Predicted Secondary structure 










Template SS confidence 



































   33......40.........50.........60........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions