Return to main results Retrieve Phyre Job Id

Job DescriptionO13535
Confidence17.03%DateMon Jul 2 19:10:10 BST 2012
Rank83Aligned Residues35
% Identity9%Templatec2l26A_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:uncharacterized protein rv0899/mt0922; PDBTitle: rv0899 from mycobacterium tuberculosis contains two separated domains
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1604.....1610.........1620.........1630.........1640.........1650
Predicted Secondary structure 
























Query SS confidence 














































Query Sequence  LFPSRQVLDMTYELIQFMWDTRDKQLIWHKNKPTEPDNKLVAISDAS
Query Conservation    
   
  
 









   

 
           
  




Alig confidence 


























............







Template Conservation 
 
       
  

  
   
   
 ............
 



  
Template Sequence  ASLIPADYEILNRVADKLKACPDARVT. . . . . . . . . . . . INGYTDNT
Template Known Secondary structure  S






TTGGGS
............


Template Predicted Secondary structure 




............



Template SS confidence 














































   230.........240.........250...... ...260....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions