Return to main results Retrieve Phyre Job Id

Job DescriptionP15891
Confidence55.97%DateMon Jul 2 19:13:22 BST 2012
Rank260Aligned Residues22
% Identity23%Templated1hc7a3
SCOP infoIF3-like C-terminal domain of ProRS C-terminal domain of ProRS
Resolution2.43

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   50.........60.........70.........80.........
Predicted Secondary structure 













Query SS confidence 







































Query Sequence  SSFHDFLQLFDETKVQYGLARVSPPGSDVEKIIIIGWCPD
Query Conservation                                          
Alig confidence 











..................









Template Conservation   
 



 

  ..................
 
 




 
Template Sequence  DTYEAFKEAVQE. . . . . . . . . . . . . . . . . . GFALAFHCGD
Template Known Secondary structure  SSTTT..................S





Template Predicted Secondary structure 


..................



Template SS confidence 







































   408.410......... 420.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions