Return to main results Retrieve Phyre Job Id

Job DescriptionP15891
Confidence23.83%DateMon Jul 2 19:13:22 BST 2012
Rank319Aligned Residues35
% Identity26%Templatec1z34A_
PDB info PDB header:transferaseChain: A: PDB Molecule:purine nucleoside phosphorylase; PDBTitle: crystal structure of trichomonas vaginalis purine nucleoside2 phosphorylase complexed with 2-fluoro-2'-deoxyadenosine
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   36...40......... 50. ........60.........70.........80........
Predicted Secondary structure 






.

......










Query SS confidence 













.

. . . . . .




































Query Sequence  SPNAKKEYEPESTG. SS. . . . . . FHDFLQLFDETKVQYGLARVSPPGSDVEKIIIIGWCP
Query Conservation                .  ......                                     
Alig confidence 



.








.

......







.................











Template Conservation     
.  
 
   


   

     

   .................    

  
 

Template Sequence  TYKG. KPISVMGHGMGLPSICIYAEELYSTY. . . . . . . . . . . . . . . . . KVKTIIRVGTCG
Template Known Secondary structure  TT.

SSTS.................


Template Predicted Secondary structure 

.




.................



Template SS confidence 



























































   51... .....60.........70.........80 .........90..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions