Return to main results Retrieve Phyre Job Id

Job DescriptionP15891
Confidence32.27%DateMon Jul 2 19:13:22 BST 2012
Rank289Aligned Residues23
% Identity30%Templatec1nj2A_
PDB info PDB header:ligaseChain: A: PDB Molecule:proline-trna synthetase; PDBTitle: crystal structure of prolyl-trna synthetase from methanothermobacter2 thermautotrophicus
Resolution3.11 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   50.........60.........70.........80 .........
Predicted Secondary structure 











.

Query SS confidence 






























.








Query Sequence  SSFHDFLQLFDETKVQYGLARVSPPGSDVEK. IIIIGWCPD
Query Conservation                                 .         
Alig confidence 












.................
.








Template Conservation               .................           
Template Sequence  ETLEEASRIVDEK. . . . . . . . . . . . . . . . . RGIISFMWCGE
Template Known Secondary structure  SS.................
S


Template Predicted Secondary structure 



.................




Template SS confidence 








































   415....420....... ..430........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions