Return to main results Retrieve Phyre Job Id

Job DescriptionP15891
Confidence32.38%DateMon Jul 2 19:13:22 BST 2012
Rank288Aligned Residues20
% Identity25%Templatec1h4tD_
PDB info PDB header:aminoacyl-trna synthetaseChain: D: PDB Molecule:prolyl-trna synthetase; PDBTitle: prolyl-trna synthetase from thermus thermophilus complexed2 with l-proline
Resolution2.9 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   52.......60.........70.........80.........
Predicted Secondary structure 











Query SS confidence 





































Query Sequence  FHDFLQLFDETKVQYGLARVSPPGSDVEKIIIIGWCPD
Query Conservation                                        
Alig confidence 









..................









Template Conservation            ..................          
Template Sequence  YEAFKEAVQE. . . . . . . . . . . . . . . . . . GFALAFHCGD
Template Known Secondary structure  TTT..................S




Template Predicted Secondary structure 
..................



Template SS confidence 





































   410......... 420.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions