Return to main results Retrieve Phyre Job Id

Job DescriptionA5Z2X5
Confidence16.35%DateMon Jul 2 19:10:01 BST 2012
Rank1Aligned Residues19
% Identity32%Templatec4f43A_
PDB info PDB header:recombination/dnaChain: A: PDB Molecule:protelomerase; PDBTitle: protelomerase tela mutant r255a complexed with caag hairpin dna
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20..... ....30........
Predicted Secondary structure 

...............
Query SS confidence 





. . . . . . . . . . . . . . .












Query Sequence  IPVELT. . . . . . . . . . . . . . . PLFLAVGVALCSG
Query Conservation 





...............


 





 
 
Alig confidence 





...............












Template Conservation       
          
 
     





 


Template Sequence  ITFENYRQVLKICEDCLKSSDPLMIGIGLIGMTG
Template Known Secondary structure 
TTTT
SS
Template Predicted Secondary structure 






Template SS confidence 

































   220.........230.........240.........250...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions