Return to main results Retrieve Phyre Job Id

Job DescriptionO13574
Confidence11.08%DateMon Jul 2 19:10:18 BST 2012
Rank8Aligned Residues27
% Identity48%Templatec2kz5A_
PDB info PDB header:transcriptionChain: A: PDB Molecule:transcription factor nf-e2 45 kda subunit; PDBTitle: solution nmr structure of transcription factor nf-e2 subunit's dna2 binding domain from homo sapiens, northeast structural genomics3 consortium target hr4653b
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   31........40.... .....50.......
Predicted Secondary structure 



........



Query SS confidence 













. . . . . . . .












Query Sequence  VAQPYSSYCGLLMR. . . . . . . . WAVVEIRRRGKGK
Query Conservation 













........












Alig confidence 













........












Template Conservation 
 


 


 

    


 

 











Template Sequence  VNLPVDDFNELLARYPLTESQLALVRDIRRRGKNK
Template Known Secondary structure  S
S


Template Predicted Secondary structure 





Template SS confidence 


































   41........50.........60.........70.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions