Return to main results Retrieve Phyre Job Id

Job DescriptionO43137
Confidence1.88%DateMon Jul 2 19:10:22 BST 2012
Rank90Aligned Residues24
% Identity21%Templatec2j6pF_
PDB info PDB header:oxidoreductaseChain: F: PDB Molecule:sb(v)-as(v) reductase; PDBTitle: structure of as-sb reductase from leishmania major
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40.........50.........60.....
Predicted Secondary structure 









Query SS confidence 

































Query Sequence  GYQEFLKKQEKKNYEIQTVLSEDKSHGYVLKDGE
Query Conservation 

 









   


 




 





 
Alig confidence 












..........










Template Conservation 
   
   
 
  ..........     
     
Template Sequence  GWEAFYHMYGDVR. . . . . . . . . . PDLMYVKLGPE
Template Known Secondary structure  TTT
..........GGG
TTT
Template Predicted Secondary structure 
..........





Template SS confidence 

































   109110.........120. ........130..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions