Return to main results Retrieve Phyre Job Id

Job DescriptionO14467
Confidence38.81%DateMon Jul 2 19:10:22 BST 2012
Rank397Aligned Residues31
% Identity13%Templatec1b9nA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:protein (mode); PDBTitle: regulator from escherichia coli
Resolution2.09 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   95....100.........110.........120.........130......
Predicted Secondary structure 












Query SS confidence 









































Query Sequence  SQKDLATKINEKPTVVNDYEAARAIPNQQVLSKLERALGVKL
Query Conservation 

 


   


   

  
 
   
    
 


  


 
Alig confidence 

















...........












Template Conservation 
 
 

  
 


 


 ........... 
  

  

  
Template Sequence  SISQGAKDAGISYKSAWD. . . . . . . . . . . AINEMNQLSEHIL
Template Known Secondary structure  ST

...........TS

Template Predicted Secondary structure 



...........

Template SS confidence 









































   33......40.........50 .........60...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions