Return to main results Retrieve Phyre Job Id

Job DescriptionO60200
Confidence2.46%DateMon Jul 2 19:10:23 BST 2012
Rank76Aligned Residues31
% Identity35%Templatec3qtmB_
PDB info PDB header:translationChain: B: PDB Molecule:uncharacterized protein c4b3.07; PDBTitle: crystal structure of nro1/ett1 protein from s. pombe (high resolution)
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30... ......40.........50....
Predicted Secondary structure  ...........






Query SS confidence 









. . . . . . . . . . .




















Query Sequence  FNEWYSEKFL. . . . . . . . . . . KGKSVENECSKQWYAYTTCVN
Query Conservation 

 

 



...........

      
   
  

 

 
Alig confidence 









...........




















Template Conservation    
   
  


       
  

         
        
Template Sequence  FGDQFSEAFLLDVSIITALWLKSVVDPNTPAYYKLIAQEAVL
Template Known Secondary structure  TGGGS


TT
STTS
Template Predicted Secondary structure 
Template SS confidence 









































   245....250.........260.........270.........280......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions