Return to main results Retrieve Phyre Job Id

Job DescriptionO60200
Confidence64.98%DateMon Jul 2 19:10:23 BST 2012
Rank6Aligned Residues32
% Identity38%Templatec2rnbA_
PDB info PDB header:metal transportChain: A: PDB Molecule:cytochrome c oxidase copper chaperone; PDBTitle: solution structure of human cu(i)cox17
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50....
Predicted Secondary structure 







Query SS confidence 









































Query Sequence  CTDLKTKYDSCFNEWYSEKFLKGKSVENECSKQWYAYTTCVN
Query Conservation 
  

  

 


 

 





      
   
  

 

 
Alig confidence 













.......

...















Template Conservation 




  



 
 ....... 
...

 
   


 
 


Template Sequence  CPETKKARDACIIE. . . . . . . KG. . . EEHCGHLIEAHKECMR
Template Known Secondary structure  S.......T
...GGG
Template Predicted Secondary structure 
..........
Template SS confidence 









































   30.........40... .. ....50.........60.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions