Return to main results Retrieve Phyre Job Id

Job DescriptionP00045
Confidence96.03%DateMon Jul 2 19:10:25 BST 2012
Rank127Aligned Residues60
% Identity25%Templatec1jmxA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:amine dehydrogenase; PDBTitle: crystal structure of a quinohemoprotein amine dehydrogenase2 from pseudomonas putida
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   16...20.........30.........40.........50.........60.........70.........80.........90.....
Predicted Secondary structure 





















































Query SS confidence 















































































Query Sequence  GATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTDANINKNVKWDEDSMSEYLTNPKKYIPGTKMAFAGL
Query Conservation 
  

   
  

     
    

 
                               
      
     
  

    
Alig confidence 





















.........................















........








Template Conservation 
  

  

  

     
 

.........................


  






 


........ 

   


Template Sequence  GPSLLQNKCMGCHIPEGNDTYS. . . . . . . . . . . . . . . . . . . . . . . . . RISHQRKTPEGWLMSI. . . . . . . . ARMQVMHGL
Template Known Secondary structure  BTTB
TTT.........................TGGG

........

Template Predicted Secondary structure 








.........................


........


Template SS confidence 















































































   4.....10.........20..... ....30.........40. ........50
 
   96...100........
Predicted Secondary structure  .

Query SS confidence  .












Query Sequence  . KKEKDRNDLITYM
Query Conservation  .

  
  





Alig confidence  .












Template Conservation   

  
   




Template Sequence  QISDDDRRTLVKYL
Template Known Secondary structure 


Template Predicted Secondary structure 


Template SS confidence 













   51........60....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions