Return to main results Retrieve Phyre Job Id

Job DescriptionO13578
Confidence4.09%DateMon Jul 2 19:10:19 BST 2012
Rank25Aligned Residues24
% Identity54%Templatec3b4sA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:protein luxt; PDBTitle: crystal structure of a luxt domain from vibrio2 parahaemolyticus rimd 2210633
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   64.....70.........80.........90.........
Predicted Secondary structure 






Query SS confidence 



































Query Sequence  LSAKPSSVFLALLAGKLAEKYIYARMLLFHVSVVNE
Query Conservation 



































Alig confidence 













............









Template Conservation   



  

 



............






  
Template Sequence  IKALEDSEFLAILR. . . . . . . . . . . . LLFHHIVTSE
Template Known Secondary structure  TTS............S
Template Predicted Secondary structure  ............
Template SS confidence 



































   88.90.........100. ........110.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions