Return to main results Retrieve Phyre Job Id

Job DescriptionO13539
Confidence9.25%DateMon Jul 2 19:10:10 BST 2012
Rank43Aligned Residues48
% Identity25%Templatec2q0oC_
PDB info PDB header:transcriptionChain: C: PDB Molecule:probable transcriptional repressor tram; PDBTitle: crystal structure of an anti-activation complex in bacterial quorum2 sensing
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   109110.........120.........130.........140.........150.........160.........170.........180.
Predicted Secondary structure 

















Query SS confidence 








































































Query Sequence  HLNRDTLRYINLLKRLSVDLAKQVEVSDPSVTVYEMDKWVPSEKLQGILEQYCAPDTDIRGVDAQIKNYLDQI
Query Conservation    
   
  



 






 


  
  
     
   

 


 


 
     
   

 

  


 
Alig confidence 








................







........

.




























Template Conservation 








................







........

.




























Template Sequence  AVYEEWLRA. . . . . . . . . . . . . . . . SDDPSISG. . . . . . . . PV. LQTLQDEYVARQKRSEAQQEELSDILDAL
Template Known Secondary structure  ................TT
TTS
.........
Template Predicted Secondary structure 
................







.........
Template SS confidence 








































































   48.50...... ...60.... .. ...70.........80.........90.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions