Return to main results Retrieve Phyre Job Id

Job DescriptionO13587
Confidence28.30%DateMon Jul 2 19:10:21 BST 2012
Rank1Aligned Residues16
% Identity44%Templated1axib1
SCOP infoImmunoglobulin-like beta-sandwich Fibronectin type III Fibronectin type III
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.....
Predicted Secondary structure 






Query SS confidence 





































Query Sequence  FSCFWRKGDVENIRKSDIGNEKKIDAKFNRLQYNLYYK
Query Conservation 





































Alig confidence 








......................






Template Conservation 





  
......................   
 
 
Template Sequence  FSCHWTDEG. . . . . . . . . . . . . . . . . . . . . . PIQLFYT
Template Known Secondary structure 



......................S
Template Predicted Secondary structure 



......................
Template SS confidence 





































   46...50.... .....60.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions