Return to main results Retrieve Phyre Job Id

Job DescriptionO13587
Confidence1.57%DateMon Jul 2 19:10:21 BST 2012
Rank72Aligned Residues25
% Identity36%Templatec3s88J_
PDB info PDB header:immune system/viral proteinChain: J: PDB Molecule:envelope glycoprotein; PDBTitle: crystal structure of sudan ebolavirus glycoprotein (strain gulu) bound2 to 16f6
Resolution3.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   68.70.........80.........90.........100
Predicted Secondary structure 









Query SS confidence 
































Query Sequence  ELFFRSCFSYTTCSLDFQGKRHQVERKAVDIVL
Query Conservation 
































Alig confidence 














........









Template Conservation 

 

 


 

 

........


 





Template Sequence  QLFLRATTELRTYTI. . . . . . . . LNRKAIDFLL
Template Known Secondary structure 


SS

T........
Template Predicted Secondary structure  ........
Template SS confidence 
































   570.........580.... .....590....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions