Return to main results Retrieve Phyre Job Id

Job DescriptionO13587
Confidence4.00%DateMon Jul 2 19:10:21 BST 2012
Rank18Aligned Residues12
% Identity50%Templatec1kf9C_
PDB info PDB header:hormone/growth factorChain: C: PDB Molecule:extracellular domain human growth hormone PDBTitle: phage display derived variant of human growth hormone2 complexed with two copies of the extracellular domain of3 its receptor
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.....
Predicted Secondary structure 






Query SS confidence 





































Query Sequence  FSCFWRKGDVENIRKSDIGNEKKIDAKFNRLQYNLYYK
Query Conservation 





































Alig confidence 




..........................






Template Conservation    
 
.......................... 
 
 
 
Template Sequence  FSCHW. . . . . . . . . . . . . . . . . . . . . . . . . . TIQLFYT
Template Known Secondary structure  ..........................



Template Predicted Secondary structure  ..........................
Template SS confidence 





































   546...550 .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions