Return to main results Retrieve Phyre Job Id

Job DescriptionO13556
Confidence2.86%DateMon Jul 2 19:10:14 BST 2012
Rank77Aligned Residues27
% Identity19%Templated2crba1
SCOP infoSpectrin repeat-like MIT domain-like MIT domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   156...160.........170.........180........
Predicted Secondary structure 











Query SS confidence 
































Query Sequence  CHEIASARPNDSSTMRTFTDFVSGAPIVRSLQK
Query Conservation 


 
                
 
 
 
  


Alig confidence 














......











Template Conservation 

  
  

 



 ......
   
 
 



Template Sequence  CHRKATTYLSEAMKL. . . . . . TESEQAHLSLEL
Template Known Secondary structure  TT......


Template Predicted Secondary structure  ......


Template SS confidence 
































   37..40.........50. ........60...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions