Return to main results Retrieve Phyre Job Id

Job DescriptionO13556
Confidence2.69%DateMon Jul 2 19:10:14 BST 2012
Rank88Aligned Residues36
% Identity25%Templatec3m8eA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:putative dna-binding protein; PDBTitle: protein structure of type iii plasmid segregation tubr
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   33......40. ........50.........60........
Predicted Secondary structure 


............












Query SS confidence 








. . . . . . . . . . . .


























Query Sequence  ITLFESIPT. . . . . . . . . . . . EVRSFYEDEKSGLIKVVKFRTGAMDRK
Query Conservation   







............
 
 

  
  
 
 
   

 
 
 
Alig confidence 








............


























Template Conservation 















































Template Sequence  PTVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKAMEMR
Template Known Secondary structure  TTSTT
TTTT


S

Template Predicted Secondary structure 















Template SS confidence 















































   55....60.........70.........80.........90.........100..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions