Return to main results Retrieve Phyre Job Id

Job DescriptionO14468
Confidence26.67%DateMon Jul 2 19:10:22 BST 2012
Rank4Aligned Residues34
% Identity26%Templated1slqa_
SCOP infoVP4 membrane interaction domain VP4 membrane interaction domain VP4 membrane interaction domain
Resolution3.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10.........20.........30.........40.........50.....
Predicted Secondary structure 





















Query SS confidence 

















































Query Sequence  LEASEEPQAPLANTSETNSIKGDTENIVTVFDLANEIEKSLKDVQRQMKE
Query Conservation 


  
 
 

  

   
 
  

  



 
  

 
 


       
Alig confidence 












.


...............

















Template Conservation   





 
   
.
 
...............
  



 
 


 
 

Template Sequence  VPSNDDYQTPITN. SVT. . . . . . . . . . . . . . . VRQDLERQLGELREEFNA
Template Known Secondary structure  S







B
.


...............

Template Predicted Secondary structure 











.
...............
Template SS confidence 

















































   474.....480...... ... 490.........500.......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions