Return to main results Retrieve Phyre Job Id

Job DescriptionO13577
Confidence22.64%DateMon Jul 2 19:10:19 BST 2012
Rank1Aligned Residues26
% Identity31%Templatec2zxcA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:neutral ceramidase; PDBTitle: seramidase complexed with c2
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   40.........50.. .......60.........
Predicted Secondary structure  .............














Query SS confidence 












. . . . . . . . . . . . .
















Query Sequence  MTVGMRIRQRVDQ. . . . . . . . . . . . . GYASRTPSTSDASLQPG
Query Conservation 











 .............

               
Alig confidence 












.............


....









Template Conservation 
  




  
           
 
 


....


 


 
 
Template Sequence  VMAGVRIRRAVQAASEAAGIRHVVFNGYA. . . . NAYASYVTTR
Template Known Secondary structure  GGGT

SB....SS




Template Predicted Secondary structure 




....








Template SS confidence 










































   414.....420.........430.........440.. .......450..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions