Return to main results Retrieve Phyre Job Id

Job DescriptionO13577
Confidence1.33%DateMon Jul 2 19:10:19 BST 2012
Rank73Aligned Residues28
% Identity36%Templatec3cj9A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:ectonucleoside triphosphate diphosphohydrolase 2; PDBTitle: structure of rattus norvegicus ntpdase2 in complex with2 calcium, amp and phosphate
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40......
Predicted Secondary structure 








Query SS confidence 









































Query Sequence  LEWASSLVPKRQLQQQQQQQEQQQQQQQDFHKDQLMTVGMRI
Query Conservation              

 
 
 
       

     







Alig confidence 









..............

















Template Conservation 
  
   

 ..............     


 
 





 
Template Sequence  LEQALRDVPR. . . . . . . . . . . . . . DRHASTPLYLGATAGMRL
Template Known Secondary structure  S
G..............GGGGG

Template Predicted Secondary structure 

..............




Template SS confidence 









































   100......... 110.........120.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions