Return to main results Retrieve Phyre Job Id

Job DescriptionO13585
Confidence18.96%DateMon Jul 2 19:10:20 BST 2012
Rank78Aligned Residues26
% Identity35%Templated2dsya1
SCOP infoTTHA1013/TTHA0281-like TTHA1013/TTHA0281-like TTHA0281-like
Resolution1.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   594.....600.. .......610.........620.........630........
Predicted Secondary structure  ...




























Query SS confidence 








. . .



































Query Sequence  LSTLESWIQ. . . NNDFCVPKPMLIDDFMWQRFPMTLIRDVGEIDLSDP
Query Conservation 

 



 
...   
                          
 
   
Alig confidence 








...







...................








Template Conservation   
 

 


  
  
  

 ...................
 

 

  
Template Sequence  QAALEDWLLFLLSRGETPPP. . . . . . . . . . . . . . . . . . . LGEVRIELP
Template Known Secondary structure  TT




...................BTTB




Template Predicted Secondary structure 






...................





Template SS confidence 















































   54.....60.........70... ......80..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions