Return to main results Retrieve Phyre Job Id

Job DescriptionO13585
Confidence16.62%DateMon Jul 2 19:10:20 BST 2012
Rank82Aligned Residues29
% Identity21%Templatec3k1tA_
PDB info PDB header:ligaseChain: A: PDB Molecule:glutamate--cysteine ligase gsha; PDBTitle: crystal structure of putative gamma-glutamylcysteine synthetase2 (yp_546622.1) from methylobacillus flagellatus kt at 1.90 a3 resolution
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   589590.........600.........610.........620.........630.
Predicted Secondary structure 























Query SS confidence 










































Query Sequence  QIRLNLSTLESWIQNNDFCVPKPMLIDDFMWQRFPMTLIRDVG
Query Conservation 


 


 



 
   
                         
Alig confidence 















..............












Template Conservation   

     

 

   ..............      


 


Template Sequence  RLLDNXPRIEHWFRSQ. . . . . . . . . . . . . . WQEYGAPFYASVD
Template Known Secondary structure  TS..............


S
Template Predicted Secondary structure  ..............





Template SS confidence 










































   20.........30..... ....40........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions