Return to main results Retrieve Phyre Job Id

Job DescriptionO13585
Confidence57.43%DateMon Jul 2 19:10:20 BST 2012
Rank67Aligned Residues23
% Identity30%Templatec3ebcA_
PDB info PDB header:hydrolase/dnaChain: A: PDB Molecule:type-2 restriction enzyme hincii; PDBTitle: structure of n141a hincii with cognate dna
Resolution2.55 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   581........590....... ..600...
Predicted Secondary structure 

........
Query SS confidence 
















. . . . . . . .





Query Sequence  SLSRAHAIQIRLNLSTL. . . . . . . . ESWIQN
Query Conservation   









 


 
........


 
 
Alig confidence 
















........





Template Conservation 













   

 
 

  

   
Template Sequence  YINWAAAMQIQFHVRDLDQGFNGTREEWAKS
Template Known Secondary structure  TTTTT

GGG





S
Template Predicted Secondary structure 



Template SS confidence 






























   199200.........210.........220.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions