Return to main results Retrieve Phyre Job Id

Job Descriptionbad_result
Confidence7.02%DateSun Sep 7 16:40:49 BST 2014
Rank77Aligned Residues38
% Identity24%Templatec4j15A_
PDB info PDB header:ligaseChain: A: PDB Molecule:aspartate--trna ligase, cytoplasmic; PDBTitle: crystal structure of human cytosolic aspartyl-trna synthetase, a2 component of multi-trna synthetase complex
Resolution2.24 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   48.50.........60.........70.........80.........90.........100.......
Predicted Secondary structure 












Query SS confidence 



























































Query Sequence  NKKENQAKAIERHLEIFNTTTVVVPAILGITAAMEEENANNPEFDESSISAVKTALMGPL
Query Conservation   
 
    

 


 



 
     
 

  



  
         
  


 




Alig confidence 









.........................



















.



Template Conservation   

       .........................       
    

 

  
. 

 
Template Sequence  HDPQLLTERA. . . . . . . . . . . . . . . . . . . . . . . . . LHHGIDLEKIKAYIDSFRFG. APPH
Template Known Secondary structure 

.........................TT

SGGGTTTT
.


Template Predicted Secondary structure 

.........................




.



Template SS confidence 



























































   433......440.. .......450.........460.. ....
 
   108.110.
Predicted Secondary structure 
Query SS confidence 



Query Sequence  AGIG
Query Conservation 



Alig confidence 



Template Conservation 

 
Template Sequence  AGGG
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 



   467..470
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D